SCOPe 2.08: Domain d1e2vb1: 1e2v B:301-468,B:533-551

Lineage for d1e2vb1 (1e2v B:301-468,B:533-551)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family)

5. Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)

6. Protein Cytochrome f, large domain [49443] (5 species)
   this domain is interrupted by a small domain which is barrel-sandwich hybrid fold

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries)

8. Domain d1e2vb1: 1e2v B:301-468,B:533-551 [22469]
   Other proteins in same PDB: d1e2va2, d1e2vb2, d1e2vc2
   complexed with act, hec; mutant

Details for d1e2vb1

PDB Entry: 1e2v, 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii

PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d1e2vb1:

Sequence; same for both SEQRES and ATOM records:

>d1e2vb1 b.2.6.1 (B:301-468,B:533-551) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar

Timeline for d1e2vb1:

• d1e2vb1 first appeared (with stable ids) in SCOP 1.55
  
• d1e2vb1 appears in SCOPe 2.07