SCOPe 2.08: Domain d1e2va2: 1e2v A:169-232

Lineage for d1e2va2 (1e2v A:169-232)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1e2va2: 1e2v A:169-232 [28254]
   Other proteins in same PDB: d1e2va1, d1e2vb1, d1e2vc1
   complexed with act, hec; mutant

Details for d1e2va2

PDB Entry: 1e2v, 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii

PDB Compounds: (A:) cytochrome f

SCOPe Domain Sequences for d1e2va2:

Sequence; same for both SEQRES and ATOM records:

>d1e2va2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1e2va2:

• d1e2va2 first appeared (with stable ids) in SCOP 1.55
  
• d1e2va2 appears in SCOPe 2.07