![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
![]() | Protein Cytochrome f, small domain [51257] (5 species) |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries) |
![]() | Domain d1e2vc2: 1e2v C:769-832 [28256] Other proteins in same PDB: d1e2va1, d1e2vb1, d1e2vc1 complexed with act, hec; mutant |
PDB Entry: 1e2v (more details), 1.85 Å
SCOPe Domain Sequences for d1e2vc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2vc2 b.84.2.2 (C:769-832) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl tnnp
Timeline for d1e2vc2:
![]() Domains from other chains: (mouse over for more information) d1e2va1, d1e2va2, d1e2vb1, d1e2vb2 |