Lineage for d1e2vc2 (1e2v C:769-832)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817636Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 2817637Protein Cytochrome f, small domain [51257] (5 species)
  7. 2817638Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)
  8. 2817643Domain d1e2vc2: 1e2v C:769-832 [28256]
    Other proteins in same PDB: d1e2va1, d1e2vb1, d1e2vc1
    complexed with act, hec; mutant

Details for d1e2vc2

PDB Entry: 1e2v (more details), 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii
PDB Compounds: (C:) cytochrome f

SCOPe Domain Sequences for d1e2vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2vc2 b.84.2.2 (C:769-832) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOPe Domain Coordinates for d1e2vc2:

Click to download the PDB-style file with coordinates for d1e2vc2.
(The format of our PDB-style files is described here.)

Timeline for d1e2vc2: