PDB entry 1e2v

View 1e2v on RCSB PDB site
Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii
Class: electron transport
Keywords: electron transport, internal water chain, photosynthetic function impaired
Deposited on 2000-05-29, released 2000-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23577
      • engineered mutation (152)
    Domains in SCOPe 2.07: d1e2va1, d1e2va2
  • Chain 'B':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23577
      • engineered mutation (152)
    Domains in SCOPe 2.07: d1e2vb1, d1e2vb2
  • Chain 'C':
    Compound: cytochrome f
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: PETA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23577 (0-250)
      • engineered mutation (152)
    Domains in SCOPe 2.07: d1e2vc1, d1e2vc2
  • Heterogens: HEC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2vA (A:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2vB (B:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e2vC (C:)
    ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
    langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
    kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnntiynasaagkiv
    aitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpltnnpnvggfgqa
    eteivlqnpar