![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (1 family) ![]() |
![]() | Family b.2.5.1: p53-like transcription factors [49418] (10 proteins) |
![]() | Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49429] (4 PDB entries) |
![]() | Domain d2ramb2: 2ram B:19-191 [22451] Other proteins in same PDB: d2rama1, d2ramb1 |
PDB Entry: 2ram (more details), 2.4 Å
SCOP Domain Sequences for d2ramb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ramb2 b.2.5.1 (B:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)} pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt
Timeline for d2ramb2: