Lineage for d2rama2 (2ram A:19-191)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10414Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 10415Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 10443Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (2 species)
  7. 10447Species Mouse (Mus musculus) [TaxId:10090] [49429] (4 PDB entries)
  8. 10449Domain d2rama2: 2ram A:19-191 [22450]
    Other proteins in same PDB: d2rama1, d2ramb1

Details for d2rama2

PDB Entry: 2ram (more details), 2.4 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer

SCOP Domain Sequences for d2rama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rama2 b.2.5.1 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOP Domain Coordinates for d2rama2:

Click to download the PDB-style file with coordinates for d2rama2.
(The format of our PDB-style files is described here.)

Timeline for d2rama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rama1