| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d4krmj_: 4krm J: [224461] Other proteins in same PDB: d4krma1, d4krma2, d4krma3, d4krmc1, d4krmc2, d4krmc3, d4krme1, d4krme2, d4krme3, d4krmg1, d4krmg2, d4krmi1, d4krmi2, d4krmi3, d4krmk1, d4krmk2, d4krmk3 automated match to d4jvpa_ complexed with nag |
PDB Entry: 4krm (more details), 2.66 Å
SCOPe Domain Sequences for d4krmj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4krmj_ b.1.1.1 (J:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
tvss
Timeline for d4krmj_: