Lineage for d4krmc1 (4krm C:311-480)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851844Protein automated matches [232361] (1 species)
    not a true protein
  7. 2851845Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries)
  8. 2851849Domain d4krmc1: 4krm C:311-480 [240446]
    Other proteins in same PDB: d4krma2, d4krma3, d4krmb_, d4krmc2, d4krmc3, d4krmd_, d4krme2, d4krme3, d4krmf_, d4krmg2, d4krmh_, d4krmi2, d4krmi3, d4krmj_, d4krmk2, d4krmk3, d4krml_
    automated match to d4krla1
    complexed with nag

Details for d4krmc1

PDB Entry: 4krm (more details), 2.66 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 3.5
PDB Compounds: (C:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4krmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4krmc1 c.10.2.5 (C:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d4krmc1:

Click to download the PDB-style file with coordinates for d4krmc1.
(The format of our PDB-style files is described here.)

Timeline for d4krmc1: