Lineage for d4krml_ (4krm L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743970Domain d4krml_: 4krm L: [224462]
    Other proteins in same PDB: d4krma1, d4krma2, d4krma3, d4krmc1, d4krmc2, d4krmc3, d4krme1, d4krme2, d4krme3, d4krmg1, d4krmg2, d4krmi1, d4krmi2, d4krmi3, d4krmk1, d4krmk2, d4krmk3
    automated match to d4jvpa_
    complexed with nag

Details for d4krml_

PDB Entry: 4krm (more details), 2.66 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 3.5
PDB Compounds: (L:) Nanobody/VHH domain 7D12

SCOPe Domain Sequences for d4krml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4krml_ b.1.1.1 (L:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
tvss

SCOPe Domain Coordinates for d4krml_:

Click to download the PDB-style file with coordinates for d4krml_.
(The format of our PDB-style files is described here.)

Timeline for d4krml_: