Lineage for d4krmj_ (4krm J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290305Domain d4krmj_: 4krm J: [224461]
    automated match to d4jvpa_
    complexed with nag

Details for d4krmj_

PDB Entry: 4krm (more details), 2.65 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 3.5
PDB Compounds: (J:) Nanobody/VHH domain 7D12

SCOPe Domain Sequences for d4krmj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4krmj_ b.1.1.1 (J:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
tvss

SCOPe Domain Coordinates for d4krmj_:

Click to download the PDB-style file with coordinates for d4krmj_.
(The format of our PDB-style files is described here.)

Timeline for d4krmj_: