SCOPe 2.03: Domain d1tupb_: 1tup B:

Lineage for d1tupb_ (1tup B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (32 PDB entries)

8. Domain d1tupb_: 1tup B: [22435]
   protein/DNA complex; complexed with zn

Details for d1tupb_

PDB Entry: 1tup, 2.2 Å

PDB Description: tumor suppressor p53 complexed with dna

PDB Compounds: (B:) protein (p53 tumor suppressor )

SCOPe Domain Sequences for d1tupb_:

Sequence; same for both SEQRES and ATOM records:

>d1tupb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

Timeline for d1tupb_:

• d1tupb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tupb_ appears in SCOPe 2.02
  
• d1tupb_ appears in SCOPe 2.04
  
• d1tupb_ appears in the current release, SCOPe 2.08