Lineage for d1tupc_ (1tup C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300967Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1300968Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1300969Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 1300970Species Human (Homo sapiens) [TaxId:9606] [49420] (32 PDB entries)
  8. 1301030Domain d1tupc_: 1tup C: [22436]
    protein/DNA complex; complexed with zn

Details for d1tupc_

PDB Entry: 1tup (more details), 2.2 Å

PDB Description: tumor suppressor p53 complexed with dna
PDB Compounds: (C:) protein (p53 tumor suppressor )

SCOPe Domain Sequences for d1tupc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tupc_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv
cacpgrdrrteeenl

SCOPe Domain Coordinates for d1tupc_:

Click to download the PDB-style file with coordinates for d1tupc_.
(The format of our PDB-style files is described here.)

Timeline for d1tupc_: