| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
| Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries) |
| Domain d1tupb_: 1tup B: [22435] protein/DNA complex; complexed with zn |
PDB Entry: 1tup (more details), 2.2 Å
SCOPe Domain Sequences for d1tupb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tupb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl
Timeline for d1tupb_: