Lineage for d1tupb_ (1tup B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112950Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1112951Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1112952Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 1112953Species Human (Homo sapiens) [TaxId:9606] [49420] (22 PDB entries)
  8. 1112982Domain d1tupb_: 1tup B: [22435]
    protein/DNA complex; complexed with zn

Details for d1tupb_

PDB Entry: 1tup (more details), 2.2 Å

PDB Description: tumor suppressor p53 complexed with dna
PDB Compounds: (B:) protein (p53 tumor suppressor )

SCOPe Domain Sequences for d1tupb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tupb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d1tupb_:

Click to download the PDB-style file with coordinates for d1tupb_.
(The format of our PDB-style files is described here.)

Timeline for d1tupb_: