Lineage for d4kgib1 (4kgi B:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880279Species Shigella flexneri [TaxId:198215] [226692] (1 PDB entry)
  8. 2880281Domain d4kgib1: 4kgi B:1-80 [224288]
    Other proteins in same PDB: d4kgia2, d4kgib2, d4kgic2, d4kgic3, d4kgid2, d4kgid3
    automated match to d1n2aa2
    complexed with gsh

Details for d4kgib1

PDB Entry: 4kgi (more details), 1.6 Å

PDB Description: Crystal structure of a glutathione transferase family member from Shigella flexneri, target EFI-507258, bound GSH, TEV-his-tag linker in active site
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4kgib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgib1 c.47.1.0 (B:1-80) automated matches {Shigella flexneri [TaxId: 198215]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpalllddg
tlltegvaimqyladsvpdr

SCOPe Domain Coordinates for d4kgib1:

Click to download the PDB-style file with coordinates for d4kgib1.
(The format of our PDB-style files is described here.)

Timeline for d4kgib1: