PDB entry 4kgi

View 4kgi on RCSB PDB site
Description: Crystal structure of a glutathione transferase family member from Shigella flexneri, target EFI-507258, bound GSH, TEV-his-tag linker in active site
Class: transferase
Keywords: GST, glutathione S-transferase fold, enzyme function initiative, EFI, Structural Genomics, TRANSFERASE
Deposited on 2013-04-29, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Shigella flexneri [TaxId:198215]
    Gene: gst, SF2457T_2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kgia1, d4kgia2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Shigella flexneri [TaxId:198215]
    Gene: gst, SF2457T_2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4kgib1, d4kgib2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: Shigella flexneri [TaxId:198215]
    Gene: gst, SF2457T_2570
    Database cross-references and differences (RAF-indexed):
    • Uniprot E3Y3H4 (22-End)
      • expression tag (16-21)
    Domains in SCOPe 2.07: d4kgic1, d4kgic2, d4kgic3
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: Shigella flexneri [TaxId:198215]
    Gene: gst, SF2457T_2570
    Database cross-references and differences (RAF-indexed):
    • Uniprot E3Y3H4 (22-End)
      • expression tag (16-21)
    Domains in SCOPe 2.07: d4kgid1, d4kgid2, d4kgid3
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kgiA (A:)
    mhhhhhhssgvdlgtenlyfqsmklfykpgacslashitlresgkdftlvsvdlmkkrle
    ngddyfsvnpkgqvpalllddgtlltegvaimqyladsvpdrqllapvnsisryktiewl
    nyiatelhkgftplfrpdtpeeykptvraqldkklqyvnealkdehwicgqrftiadayl
    ftvlrwayavklnleglehiaafmqrmaerpevqdalsaeglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgiA (A:)
    mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpalllddg
    tlltegvaimqyladsvpdrqllapvnsisryktiewlnyiatelhkgftplfrpdtpee
    ykptvraqldkklqyvnealkdehwicgqrftiadaylftvlrwayavklnleglehiaa
    fmqrmaerpevqdalsaegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kgiB (B:)
    mhhhhhhssgvdlgtenlyfqsmklfykpgacslashitlresgkdftlvsvdlmkkrle
    ngddyfsvnpkgqvpalllddgtlltegvaimqyladsvpdrqllapvnsisryktiewl
    nyiatelhkgftplfrpdtpeeykptvraqldkklqyvnealkdehwicgqrftiadayl
    ftvlrwayavklnleglehiaafmqrmaerpevqdalsaeglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgiB (B:)
    mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpalllddg
    tlltegvaimqyladsvpdrqllapvnsisryktiewlnyiatelhkgftplfrpdtpee
    ykptvraqldkklqyvnealkdehwicgqrftiadaylftvlrwayavklnleglehiaa
    fmqrmaerpevqdalsaegl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kgiC (C:)
    mhhhhhhssgvdlgtenlyfqsmklfykpgacslashitlresgkdftlvsvdlmkkrle
    ngddyfsvnpkgqvpalllddgtlltegvaimqyladsvpdrqllapvnsisryktiewl
    nyiatelhkgftplfrpdtpeeykptvraqldkklqyvnealkdehwicgqrftiadayl
    ftvlrwayavklnleglehiaafmqrmaerpevqdalsaeglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgiC (C:)
    nlyfqsmklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpa
    lllddgtlltegvaimqyladsvpdrqllapvnsisryktiewlnyiatelhkgftplfr
    pdtpeeykptvraqldkklqyvnealkdehwicgqrftiadaylftvlrwayavklnleg
    lehiaafmqrmaerpevqdalsaegl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kgiD (D:)
    mhhhhhhssgvdlgtenlyfqsmklfykpgacslashitlresgkdftlvsvdlmkkrle
    ngddyfsvnpkgqvpalllddgtlltegvaimqyladsvpdrqllapvnsisryktiewl
    nyiatelhkgftplfrpdtpeeykptvraqldkklqyvnealkdehwicgqrftiadayl
    ftvlrwayavklnleglehiaafmqrmaerpevqdalsaeglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kgiD (D:)
    nlyfqsmklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfsvnpkgqvpa
    lllddgtlltegvaimqyladsvpdrqllapvnsisryktiewlnyiatelhkgftplfr
    pdtpeeykptvraqldkklqyvnealkdehwicgqrftiadaylftvlrwayavklnleg
    lehiaafmqrmaerpevqdalsaegl