Lineage for d4kgia2 (4kgi A:81-200)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713718Species Shigella flexneri [TaxId:198215] [226693] (1 PDB entry)
  8. 2713719Domain d4kgia2: 4kgi A:81-200 [224287]
    Other proteins in same PDB: d4kgia1, d4kgib1, d4kgic1, d4kgic3, d4kgid1, d4kgid3
    automated match to d1n2aa1
    complexed with gsh

Details for d4kgia2

PDB Entry: 4kgi (more details), 1.6 Å

PDB Description: Crystal structure of a glutathione transferase family member from Shigella flexneri, target EFI-507258, bound GSH, TEV-his-tag linker in active site
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4kgia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgia2 a.45.1.1 (A:81-200) automated matches {Shigella flexneri [TaxId: 198215]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqldkklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl

SCOPe Domain Coordinates for d4kgia2:

Click to download the PDB-style file with coordinates for d4kgia2.
(The format of our PDB-style files is described here.)

Timeline for d4kgia2: