Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Brucella abortus [TaxId:359391] [226652] (1 PDB entry) |
Domain d4jwpb_: 4jwp B: [224047] Other proteins in same PDB: d4jwpa2 automated match to d1vhsa_ complexed with aco, ca, cl |
PDB Entry: 4jwp (more details), 2 Å
SCOPe Domain Sequences for d4jwpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jwpb_ d.108.1.0 (B:) automated matches {Brucella abortus [TaxId: 359391]} tllirhateadlpallaiyndaventlaiwnetlvdlenrhqwlenrnrdgfpvlvaere gqvvgyasygpfrpfegfrhsselsvyvasnargggigrtllaelieearerkvhvliag ieagnaasialhrsqgfeecgtlkqvgqkfgrwldllfmqkil
Timeline for d4jwpb_: