SCOPe 2.03: Domain d4jwpb_: 4jwp B:

Lineage for d4jwpb_ (4jwp B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (22 species)
   not a true protein

7. Species Brucella abortus [TaxId:359391] [226652] (1 PDB entry)

8. Domain d4jwpb_: 4jwp B: [224047]
   automated match to d1vhsa_
   complexed with aco, ca, cl

Details for d4jwpb_

PDB Entry: 4jwp, 2 Å

PDB Description: crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa

PDB Compounds: (B:) GCN5-related N-acetyltransferase

SCOPe Domain Sequences for d4jwpb_:

Sequence; same for both SEQRES and ATOM records:

>d4jwpb_ d.108.1.0 (B:) automated matches {Brucella abortus [TaxId: 359391]}
tllirhateadlpallaiyndaventlaiwnetlvdlenrhqwlenrnrdgfpvlvaere
gqvvgyasygpfrpfegfrhsselsvyvasnargggigrtllaelieearerkvhvliag
ieagnaasialhrsqgfeecgtlkqvgqkfgrwldllfmqkil

Timeline for d4jwpb_:

• d4jwpb_ is new in SCOPe 2.03-stable
  
• d4jwpb_ appears in SCOPe 2.04
  
• d4jwpb_ appears in the current release, SCOPe 2.08