Lineage for d4jwpa1 (4jwp A:1-164)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969034Species Brucella abortus [TaxId:359391] [226652] (1 PDB entry)
  8. 2969035Domain d4jwpa1: 4jwp A:1-164 [224046]
    Other proteins in same PDB: d4jwpa2
    automated match to d1vhsa_
    complexed with aco, ca, cl

Details for d4jwpa1

PDB Entry: 4jwp (more details), 2 Å

PDB Description: crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
PDB Compounds: (A:) GCN5-related N-acetyltransferase

SCOPe Domain Sequences for d4jwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jwpa1 d.108.1.0 (A:1-164) automated matches {Brucella abortus [TaxId: 359391]}
mtllirhateadlpallaiyndaventlaiwnetlvdlenrhqwlenrnrdgfpvlvaer
egqvvgyasygpfrpfegfrhsselsvyvasnargggigrtllaelieearerkvhvlia
gieagnaasialhrsqgfeecgtlkqvgqkfgrwldllfmqkil

SCOPe Domain Coordinates for d4jwpa1:

Click to download the PDB-style file with coordinates for d4jwpa1.
(The format of our PDB-style files is described here.)

Timeline for d4jwpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jwpa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jwpb_