SCOP 1.55: Domain d3kbpd1: 3kbp D:9-120

Lineage for d3kbpd1 (3kbp D:9-120)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family)

5. Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)

6. Protein Purple acid phosphatase, N-terminal domain [49365] (1 species)

7. Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)

8. Domain d3kbpd1: 3kbp D:9-120 [22356]
   Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2

Details for d3kbpd1

PDB Entry: 3kbp, 3 Å

PDB Description: kidney bean purple acid phosphatase

SCOP Domain Sequences for d3kbpd1:

Sequence; same for both SEQRES and ATOM records:

>d3kbpd1 b.1.12.1 (D:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris)}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d3kbpd1:

• d3kbpd1 appears in SCOP 1.57
  
• d3kbpd1 appears in the current release, SCOPe 2.08