Lineage for d3kbpd1 (3kbp D:9-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764739Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2764740Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 2764741Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)
  8. 2764754Domain d3kbpd1: 3kbp D:9-120 [22356]
    Other proteins in same PDB: d3kbpa2, d3kbpb2, d3kbpc2, d3kbpd2
    complexed with fe, nag, wo4, zn

Details for d3kbpd1

PDB Entry: 3kbp (more details), 3 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (D:) purple acid phosphatase

SCOPe Domain Sequences for d3kbpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kbpd1 b.1.12.1 (D:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d3kbpd1:

Click to download the PDB-style file with coordinates for d3kbpd1.
(The format of our PDB-style files is described here.)

Timeline for d3kbpd1: