PDB entry 3kbp

View 3kbp on RCSB PDB site
Description: kidney bean purple acid phosphatase
Class: hydrolase (phosphoric monoester)
Keywords: purple acid phosphatase, hydrolase (phosphoric monoester)
Deposited on 1995-10-02, released 1996-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.08: d3kbpa1, d3kbpa2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.08: d3kbpb1, d3kbpb2
  • Chain 'C':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.08: d3kbpc1, d3kbpc2
  • Chain 'D':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80366 (Start-431)
      • conflict (252-253)
    Domains in SCOPe 2.08: d3kbpd1, d3kbpd2
  • Heterogens: NAG, FE, ZN, WO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kbpA (A:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbpA (A:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3kbpB (B:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbpB (B:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3kbpC (C:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbpC (C:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3kbpD (D:)
    fvrktnknrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavryw
    sekngrkriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
    qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
    twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
    krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
    eamrtkfeawfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitig
    dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
    fnrhwypvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kbpD (D:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst