Lineage for d1kbpa1 (1kbp A:9-120)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10272Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) (S)
  5. 10273Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 10274Protein Purple acid phosphatase, N-terminal domain [49365] (1 species)
  7. 10275Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)
  8. 10280Domain d1kbpa1: 1kbp A:9-120 [22349]
    Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2

Details for d1kbpa1

PDB Entry: 1kbp (more details), 2.9 Å

PDB Description: kidney bean purple acid phosphatase

SCOP Domain Sequences for d1kbpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbpa1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris)}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOP Domain Coordinates for d1kbpa1:

Click to download the PDB-style file with coordinates for d1kbpa1.
(The format of our PDB-style files is described here.)

Timeline for d1kbpa1: