PDB entry 1kbp

View 1kbp on RCSB PDB site
Description: kidney bean purple acid phosphatase
Deposited on 1995-02-20, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbpA (A:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbpB (B:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbpC (C:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbpD (D:)
    rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
    iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvpy
    tfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfter
    svayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahii
    vlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkfe
    awfvkykvdvvfaghvhayerservsniaykitdglctpvkdqsapvyitigdagnygvi
    dsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwypv
    ddst