Lineage for d4ig8a2 (4ig8 A:202-346)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017952Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2017953Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2017969Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein)
    automatically mapped to Pfam PF10421
  6. 2017970Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (2 species)
  7. 2017971Species Human (Homo sapiens) [TaxId:9606] [254761] (1 PDB entry)
  8. 2017972Domain d4ig8a2: 4ig8 A:202-346 [223163]
    Other proteins in same PDB: d4ig8a1
    automated match to d1px5a1
    protein/RNA complex; complexed with dtp, mg

Details for d4ig8a2

PDB Entry: 4ig8 (more details), 2.7 Å

PDB Description: Structural basis for cytosolic double-stranded RNA surveillance by human OAS1
PDB Compounds: (A:) 2'-5'-oligoadenylate synthase 1

SCOPe Domain Sequences for d4ig8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ig8a2 a.160.1.2 (A:202-346) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Human (Homo sapiens) [TaxId: 9606]}
ptklkslirlvkhwyqnckkklgklppqyalelltvyawergsmkthfntaqgfrtvlel
vinyqqlciywtkyydfknpiiekylrrqltkprpvildpadptgnlgggdpkgwrqlaq
eaeawlnypcfknwdgspvsswill

SCOPe Domain Coordinates for d4ig8a2:

Click to download the PDB-style file with coordinates for d4ig8a2.
(The format of our PDB-style files is described here.)

Timeline for d4ig8a2: