Lineage for d1px5a1 (1px5 A:201-346)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017952Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2017953Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2017969Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein)
    automatically mapped to Pfam PF10421
  6. 2017970Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (2 species)
  7. 2017973Species Pig (Sus scrofa) [TaxId:9823] [101273] (2 PDB entries)
  8. 2017974Domain d1px5a1: 1px5 A:201-346 [95277]
    Other proteins in same PDB: d1px5a2, d1px5b2
    complexed with so4

Details for d1px5a1

PDB Entry: 1px5 (more details), 1.74 Å

PDB Description: Crystal structure of the 2'-specific and double-stranded RNA-activated interferon-induced antiviral protein 2'-5'-oligoadenylate synthetase
PDB Compounds: (A:) 2'-5'-oligoadenylate synthetase 1

SCOPe Domain Sequences for d1px5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px5a1 a.160.1.2 (A:201-346) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Pig (Sus scrofa) [TaxId: 9823]}
ptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktdfstaqgfqtvle
lvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnvgggdthswqrla
qearvwlgypccknldgslvgawtml

SCOPe Domain Coordinates for d1px5a1:

Click to download the PDB-style file with coordinates for d1px5a1.
(The format of our PDB-style files is described here.)

Timeline for d1px5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px5a2