![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (6 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.0: automated matches [227288] (1 protein) not a true family |
![]() | Protein automated matches [227106] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226560] (1 PDB entry) |
![]() | Domain d4ig8a2: 4ig8 A:202-346 [223163] Other proteins in same PDB: d4ig8a1 automated match to d1px5a1 protein/RNA complex; complexed with dtp, mg |
PDB Entry: 4ig8 (more details), 2.7 Å
SCOPe Domain Sequences for d4ig8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ig8a2 a.160.1.0 (A:202-346) automated matches {Human (Homo sapiens) [TaxId: 9606]} ptklkslirlvkhwyqnckkklgklppqyalelltvyawergsmkthfntaqgfrtvlel vinyqqlciywtkyydfknpiiekylrrqltkprpvildpadptgnlgggdpkgwrqlaq eaeawlnypcfknwdgspvsswill
Timeline for d4ig8a2: