SCOPe 2.08: Domain d4ig8a2: 4ig8 A:202-346

Lineage for d4ig8a2 (4ig8 A:202-346)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein)
   automatically mapped to Pfam PF10421

6. Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254761] (1 PDB entry)

8. Domain d4ig8a2: 4ig8 A:202-346 [223163]
   Other proteins in same PDB: d4ig8a1
   automated match to d1px5a1
   protein/RNA complex; complexed with dtp, mg

Details for d4ig8a2

PDB Entry: 4ig8, 2.7 Å

PDB Description: Structural basis for cytosolic double-stranded RNA surveillance by human OAS1

PDB Compounds: (A:) 2'-5'-oligoadenylate synthase 1

SCOPe Domain Sequences for d4ig8a2:

Sequence; same for both SEQRES and ATOM records:

>d4ig8a2 a.160.1.2 (A:202-346) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Human (Homo sapiens) [TaxId: 9606]}
ptklkslirlvkhwyqnckkklgklppqyalelltvyawergsmkthfntaqgfrtvlel
vinyqqlciywtkyydfknpiiekylrrqltkprpvildpadptgnlgggdpkgwrqlaq
eaeawlnypcfknwdgspvsswill

Timeline for d4ig8a2:

• d4ig8a2 first appeared in SCOPe 2.03
  
• d4ig8a2 appears in SCOPe 2.07