Lineage for d4g2pb_ (4g2p B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644293Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1644590Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1644591Protein automated matches [191162] (20 species)
    not a true protein
  7. 1644673Species Salmonella enterica [TaxId:588858] [226427] (1 PDB entry)
  8. 1644675Domain d4g2pb_: 4g2p B: [221671]
    automated match to d1eq3a_
    complexed with gol, so4

Details for d4g2pb_

PDB Entry: 4g2p (more details), 1.82 Å

PDB Description: Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
PDB Compounds: (B:) Chaperone surA

SCOPe Domain Sequences for d4g2pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g2pb_ d.26.1.0 (B:) automated matches {Salmonella enterica [TaxId: 588858]}
aisvtevharhillkpspimndqqarlkleeiaadiksgkttfaaaakeysqdpgsanqg
gdlgwatpdifdpafrdaltklhkgqisapvhssfgwhlielldtrkv

SCOPe Domain Coordinates for d4g2pb_:

Click to download the PDB-style file with coordinates for d4g2pb_.
(The format of our PDB-style files is described here.)

Timeline for d4g2pb_: