| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (11 species) not a true protein |
| Species Salmonella enterica [TaxId:588858] [226427] (1 PDB entry) |
| Domain d4g2pb_: 4g2p B: [221671] automated match to d1eq3a_ complexed with gol, so4 |
PDB Entry: 4g2p (more details), 1.82 Å
SCOPe Domain Sequences for d4g2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g2pb_ d.26.1.0 (B:) automated matches {Salmonella enterica [TaxId: 588858]}
aisvtevharhillkpspimndqqarlkleeiaadiksgkttfaaaakeysqdpgsanqg
gdlgwatpdifdpafrdaltklhkgqisapvhssfgwhlielldtrkv
Timeline for d4g2pb_: