SCOPe 2.08: Domain d4g2pb1: 4g2p B:280-386

Lineage for d4g2pb1 (4g2p B:280-386)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Salmonella enterica [TaxId:588858] [226427] (1 PDB entry)

8. Domain d4g2pb1: 4g2p B:280-386 [221671]
   Other proteins in same PDB: d4g2pa2, d4g2pb2
   automated match to d1eq3a_
   complexed with gol, so4

Details for d4g2pb1

PDB Entry: 4g2p, 1.82 Å

PDB Description: Crystal structure of peptidyl-prolyl cis-trans isomerase domain II of molecular chaperone SurA from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

PDB Compounds: (B:) Chaperone surA

SCOPe Domain Sequences for d4g2pb1:

Sequence; same for both SEQRES and ATOM records:

>d4g2pb1 d.26.1.0 (B:280-386) automated matches {Salmonella enterica [TaxId: 588858]}
isvtevharhillkpspimndqqarlkleeiaadiksgkttfaaaakeysqdpgsanqgg
dlgwatpdifdpafrdaltklhkgqisapvhssfgwhlielldtrkv

Timeline for d4g2pb1:

• d4g2pb1 first appeared in SCOPe 2.03, called d4g2pb_
  
• d4g2pb1 appears in SCOPe 2.07