Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Salmonella enterica [TaxId:588858] [226427] (1 PDB entry) |
Domain d4g2pb1: 4g2p B:280-386 [221671] Other proteins in same PDB: d4g2pa2, d4g2pb2 automated match to d1eq3a_ complexed with gol, so4 |
PDB Entry: 4g2p (more details), 1.82 Å
SCOPe Domain Sequences for d4g2pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g2pb1 d.26.1.0 (B:280-386) automated matches {Salmonella enterica [TaxId: 588858]} isvtevharhillkpspimndqqarlkleeiaadiksgkttfaaaakeysqdpgsanqgg dlgwatpdifdpafrdaltklhkgqisapvhssfgwhlielldtrkv
Timeline for d4g2pb1: