![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein D2 core SNRNP protein [50186] (3 species) 3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224862] (1 PDB entry) |
![]() | Domain d4f7ub_: 4f7u B: [221063] Other proteins in same PDB: d4f7ua_, d4f7uc_, d4f7ue_, d4f7uf_, d4f7ug_, d4f7uh_, d4f7ui_, d4f7uj_ automated match to d1b34b_ complexed with p6g |
PDB Entry: 4f7u (more details), 1.9 Å
SCOPe Domain Sequences for d4f7ub_:
Sequence, based on SEQRES records: (download)
>d4f7ub_ b.38.1.1 (B:) D2 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]} eefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksg kgkkkskpvnkdryiskmflrgdsvivvlrnpl
>d4f7ub_ b.38.1.1 (B:) D2 core SNRNP protein {Mouse (Mus musculus) [TaxId: 10090]} eefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevnkdr yiskmflrgdsvivvlrnpl
Timeline for d4f7ub_: