Lineage for d1b34b_ (1b34 B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.38: Sm-like fold [50181] (5 superfamilies)
core: barrel, open; n*=4, S*=8; meander; SH3-like topologySuperfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) 
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
forms homo and heteroheptameric ring structures
Pfam PF01423
Protein D2 core SNRNP protein [50186] (3 species)
3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive
Species Human (Homo sapiens) [TaxId:9606] [50187] (11 PDB entries) 
Domain d1b34b_: 1b34 B: [24797]
Other proteins in same PDB: d1b34a_
protein/RNA complex
Details for d1b34b_
PDB Entry: 1b34 (more details), 2.5 Å
PDB Description: crystal structure of the d1d2 sub-complex from the human snrnp core domain
PDB Compounds: (B:) protein (small nuclear ribonucleoprotein sm d2)SCOPe Domain Sequences for d1b34b_:
Sequence, based on SEQRES records: (download)
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksgkgkk
kskpvnkdryiskmflrgdsvivvlrnpliagk
Sequence, based on observed residues (ATOM records): (download)
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemdryiskmflrgd
svivvlrnpliagk
SCOPe Domain Coordinates for d1b34b_:
Click to download the PDB-style file with coordinates for d1b34b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b34b_:
- d1b34b_ first appeared (with stable ids) in SCOP 1.55
- d1b34b_ appears in SCOPe 2.06
View in 3D
