Lineage for d1f6fc2 (1f6f C:101-204)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9915Protein Prolactin receptor [49284] (2 species)
  7. 9919Species Rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)
  8. 9923Domain d1f6fc2: 1f6f C:101-204 [22036]
    Other proteins in same PDB: d1f6fa_

Details for d1f6fc2

PDB Entry: 1f6f (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor

SCOP Domain Sequences for d1f6fc2:

Sequence, based on SEQRES records: (download)

>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Rat (Rattus norvegicus)}
vepepprnltlevkqlkdkktylwvkwspptitdvktgwftmeyeirlkpeeaeeweihf
tghqtqfkvfdlypgqkylvqtrckpdhgywsrwsqessvempn

Sequence, based on observed residues (ATOM records): (download)

>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Rat (Rattus norvegicus)}
vepepprnltlevkktylwvkwspptmeyeirlkeweihftghqtqfkvfdlypgqkylv
qtrckpdhgywsrwsqessvempn

SCOP Domain Coordinates for d1f6fc2:

Click to download the PDB-style file with coordinates for d1f6fc2.
(The format of our PDB-style files is described here.)

Timeline for d1f6fc2: