![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Prolactin receptor [49284] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry) |
![]() | Domain d1f6fc2: 1f6f C:101-204 [22036] Other proteins in same PDB: d1f6fa_ |
PDB Entry: 1f6f (more details), 2.3 Å
SCOPe Domain Sequences for d1f6fc2:
Sequence, based on SEQRES records: (download)
>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]} vepepprnltlevkqlkdkktylwvkwspptitdvktgwftmeyeirlkpeeaeeweihf tghqtqfkvfdlypgqkylvqtrckpdhgywsrwsqessvempn
>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]} vepepprnltlevkktylwvkwspptmeyeirlkeweihftghqtqfkvfdlypgqkylv qtrckpdhgywsrwsqessvempn
Timeline for d1f6fc2: