Lineage for d1f6fc2 (1f6f C:101-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762094Protein Prolactin receptor [49284] (2 species)
  7. 2762098Species Norway rat (Rattus norvegicus) [TaxId:10116] [49286] (1 PDB entry)
  8. 2762102Domain d1f6fc2: 1f6f C:101-204 [22036]
    Other proteins in same PDB: d1f6fa_

Details for d1f6fc2

PDB Entry: 1f6f (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex between ovine placental lactogen and the extracellular domain of the rat prolactin receptor
PDB Compounds: (C:) Prolactin receptor

SCOPe Domain Sequences for d1f6fc2:

Sequence, based on SEQRES records: (download)

>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vepepprnltlevkqlkdkktylwvkwspptitdvktgwftmeyeirlkpeeaeeweihf
tghqtqfkvfdlypgqkylvqtrckpdhgywsrwsqessvempn

Sequence, based on observed residues (ATOM records): (download)

>d1f6fc2 b.1.2.1 (C:101-204) Prolactin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vepepprnltlevkktylwvkwspptmeyeirlkeweihftghqtqfkvfdlypgqkylv
qtrckpdhgywsrwsqessvempn

SCOPe Domain Coordinates for d1f6fc2:

Click to download the PDB-style file with coordinates for d1f6fc2.
(The format of our PDB-style files is described here.)

Timeline for d1f6fc2: