SCOPe 2.07: Domain d4dwhc2: 4dwh C:122-205

Lineage for d4dwhc2 (4dwh C:122-205)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (9 PDB entries)

8. Domain d4dwhc2: 4dwh C:122-205 [220063]
   Other proteins in same PDB: d4dwha1, d4dwhc1
   automated match to d1bf8a2
   complexed with peg, pg4, pge, po4

Details for d4dwhc2

PDB Entry: 4dwh, 2.5 Å

PDB Description: structure of the major type 1 pilus subunit fima bound to the fimc (2.5 a resolution)

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d4dwhc2:

Sequence; same for both SEQRES and ATOM records:

>d4dwhc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

Timeline for d4dwhc2:

• d4dwhc2 first appeared in SCOPe 2.03
  
• d4dwhc2 appears in SCOPe 2.06
  
• d4dwhc2 appears in the current release, SCOPe 2.08