SCOPe 2.07: Domain d4dwhc1: 4dwh C:1-121

Lineage for d4dwhc1 (4dwh C:1-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (9 PDB entries)

8. Domain d4dwhc1: 4dwh C:1-121 [220062]
   Other proteins in same PDB: d4dwha2, d4dwhc2
   automated match to d1bf8a1
   complexed with peg, pg4, pge, po4

Details for d4dwhc1

PDB Entry: 4dwh, 2.5 Å

PDB Description: structure of the major type 1 pilus subunit fima bound to the fimc (2.5 a resolution)

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d4dwhc1:

Sequence, based on SEQRES records:

>d4dwhc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Sequence, based on observed residues (ATOM records):

>d4dwhc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkentlqlaiisriklyyrpakla

Timeline for d4dwhc1:

• d4dwhc1 first appeared in SCOPe 2.03
  
• d4dwhc1 appears in SCOPe 2.06
  
• d4dwhc1 appears in the current release, SCOPe 2.08