Lineage for d4dwhc1 (4dwh C:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764597Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2764615Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 2764616Species Escherichia coli [TaxId:562] [49359] (11 PDB entries)
  8. 2764624Domain d4dwhc1: 4dwh C:1-121 [220062]
    Other proteins in same PDB: d4dwha2, d4dwhc2
    automated match to d1bf8a1
    complexed with peg, pg4, pge, po4

Details for d4dwhc1

PDB Entry: 4dwh (more details), 2.5 Å

PDB Description: structure of the major type 1 pilus subunit fima bound to the fimc (2.5 a resolution)
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d4dwhc1:

Sequence, based on SEQRES records: (download)

>d4dwhc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Sequence, based on observed residues (ATOM records): (download)

>d4dwhc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkentlqlaiisriklyyrpakla

SCOPe Domain Coordinates for d4dwhc1:

Click to download the PDB-style file with coordinates for d4dwhc1.
(The format of our PDB-style files is described here.)

Timeline for d4dwhc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dwhc2