Lineage for d4dwha2 (4dwh A:122-204)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382837Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2382838Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2382856Protein FimC [49588] (1 species)
  7. 2382857Species Escherichia coli [TaxId:562] [49589] (9 PDB entries)
  8. 2382864Domain d4dwha2: 4dwh A:122-204 [220061]
    Other proteins in same PDB: d4dwha1, d4dwhc1
    automated match to d1bf8a2
    complexed with peg, pg4, pge, po4

Details for d4dwha2

PDB Entry: 4dwh (more details), 2.5 Å

PDB Description: structure of the major type 1 pilus subunit fima bound to the fimc (2.5 a resolution)
PDB Compounds: (A:) chaperone protein fimc

SCOPe Domain Sequences for d4dwha2:

Sequence, based on SEQRES records: (download)

>d4dwha2 b.7.2.1 (A:122-204) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvm

Sequence, based on observed residues (ATOM records): (download)

>d4dwha2 b.7.2.1 (A:122-204) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsgs
nityrtindygaltpkmtgvm

SCOPe Domain Coordinates for d4dwha2:

Click to download the PDB-style file with coordinates for d4dwha2.
(The format of our PDB-style files is described here.)

Timeline for d4dwha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dwha1