Lineage for d4dwhc2 (4dwh C:122-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773170Protein FimC [49588] (1 species)
  7. 2773171Species Escherichia coli [TaxId:562] [49589] (11 PDB entries)
  8. 2773179Domain d4dwhc2: 4dwh C:122-205 [220063]
    Other proteins in same PDB: d4dwha1, d4dwhc1
    automated match to d1bf8a2
    complexed with peg, pg4, pge, po4

Details for d4dwhc2

PDB Entry: 4dwh (more details), 2.5 Å

PDB Description: structure of the major type 1 pilus subunit fima bound to the fimc (2.5 a resolution)
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d4dwhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dwhc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d4dwhc2:

Click to download the PDB-style file with coordinates for d4dwhc2.
(The format of our PDB-style files is described here.)

Timeline for d4dwhc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dwhc1