Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (15 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [226323] (2 PDB entries) |
Domain d4dqlb2: 4dql B:888-1049 [219943] Other proteins in same PDB: d4dqla1, d4dqlb1 automated match to d1tlla3 complexed with 1pe, fad, nap, pg4, so4 |
PDB Entry: 4dql (more details), 2.15 Å
SCOPe Domain Sequences for d4dqlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dqlb2 c.25.1.0 (B:888-1049) automated matches {Bacillus megaterium [TaxId: 1404]} eftlpkdpetplimvgpgtgvapfrgfvqarkqlkeqgqslgeahlyfgcrsphedylyq eelenaqsegiitlhtafsrmpnqpktyvqhvmeqdgkklielldqgahfyicgdgsqma paveatlmksyadvhqvseadarlwlqqleekgryakdvwag
Timeline for d4dqlb2: