SCOPe 2.04: Domain d4dqlb1: 4dql B:658-887

Lineage for d4dqlb1 (4dql B:658-887)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [226322] (2 PDB entries)

8. Domain d4dqlb1: 4dql B:658-887 [219942]
   Other proteins in same PDB: d4dqla2, d4dqlb2
   automated match to d1tlla1
   complexed with 1pe, fad, nap, pg4, so4

Details for d4dqlb1

PDB Entry: 4dql, 2.15 Å

PDB Description: Crystal structure of the FAD binding domain of cytochrome P450 BM3 in complex with NADP+

PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4dqlb1:

Sequence, based on SEQRES records:

>d4dqlb1 b.43.4.0 (B:658-887) automated matches {Bacillus megaterium [TaxId: 1404]}
kmhgafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvta
rfgldasqqirleaeeeklahlplaktvsveellqyvelqdpvtrtqlramaaktvcpph
kveleallekqaykeqvlakrltmlellekypacemkfsefiallpsirpryysissspr
vdekqasitvsvvsgeawsgygeykgiasnylaelqegdtitcfistpqs

Sequence, based on observed residues (ATOM records):

>d4dqlb1 b.43.4.0 (B:658-887) automated matches {Bacillus megaterium [TaxId: 1404]}
kmhgafstnvvaskelqqpgsarstrhleielpkeasyqegdhlgviprnyegivnrvta
rfgldasqqirlktvsveellqyvelqdpvtrtqlramaaktvcpphkveleallekqay
keqvlakrltmlellekypacemkfsefiallpsirpryysisssprvdekqasitvsvv
sgeawsgygeykgiasnylaelqegdtitcfistpqs

Timeline for d4dqlb1:

• d4dqlb1 first appeared in SCOPe 2.03
  
• d4dqlb1 appears in SCOPe 2.05
  
• d4dqlb1 appears in the current release, SCOPe 2.08