SCOPe 2.08: Domain d4dqlb2: 4dql B:888-1049

Lineage for d4dqlb2 (4dql B:888-1049)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [226323] (2 PDB entries)

8. Domain d4dqlb2: 4dql B:888-1049 [219943]
   Other proteins in same PDB: d4dqla1, d4dqlb1
   automated match to d1tlla3
   complexed with 1pe, fad, nap, pg4, so4

Details for d4dqlb2

PDB Entry: 4dql, 2.15 Å

PDB Description: Crystal structure of the FAD binding domain of cytochrome P450 BM3 in complex with NADP+

PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d4dqlb2:

Sequence; same for both SEQRES and ATOM records:

>d4dqlb2 c.25.1.0 (B:888-1049) automated matches {Bacillus megaterium [TaxId: 1404]}
eftlpkdpetplimvgpgtgvapfrgfvqarkqlkeqgqslgeahlyfgcrsphedylyq
eelenaqsegiitlhtafsrmpnqpktyvqhvmeqdgkklielldqgahfyicgdgsqma
paveatlmksyadvhqvseadarlwlqqleekgryakdvwag

Timeline for d4dqlb2:

• d4dqlb2 first appeared in SCOPe 2.03
  
• d4dqlb2 appears in SCOPe 2.07