Lineage for d1fnf_1 (1fnf 1142-1235)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105306Protein Fibronectin, different Fn3 modules [49270] (2 species)
  7. 105307Species Human (Homo sapiens) [TaxId:9606] [49271] (7 PDB entries)
  8. 105309Domain d1fnf_1: 1fnf 1142-1235 [21972]

Details for d1fnf_1

PDB Entry: 1fnf (more details), 2 Å

PDB Description: fragment of human fibronectin encompassing type-iii repeats 7 through 10

SCOP Domain Sequences for d1fnf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnf_1 b.1.2.1 (1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens)}
plspptnlhleanpdtgvltvswersttpditgyritttptngqqgnsleevvhadqssc
tfdnlspgleynvsvytvkddkesvpisdtiipa

SCOP Domain Coordinates for d1fnf_1:

Click to download the PDB-style file with coordinates for d1fnf_1.
(The format of our PDB-style files is described here.)

Timeline for d1fnf_1: