Lineage for d1fnf_1 (1fnf 1142-1235)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) 
Protein Fibronectin, different Fn3 modules [49270] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49271] (6 PDB entries) 
Domain d1fnf_1: 1fnf 1142-1235 [21972]
Details for d1fnf_1
PDB Entry: 1fnf (more details), 2 Å
PDB Description: fragment of human fibronectin encompassing type-iii repeats 7 through 10
SCOP Domain Sequences for d1fnf_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnf_1 b.1.2.1 (1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens)}
plspptnlhleanpdtgvltvswersttpditgyritttptngqqgnsleevvhadqssc
tfdnlspgleynvsvytvkddkesvpisdtiipa
SCOP Domain Coordinates for d1fnf_1:
Click to download the PDB-style file with coordinates for d1fnf_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnf_1:
- d1fnf_1 appears in SCOP 1.57
- d1fnf_1 appears in the current release, SCOPe 2.08, called d1fnfa1
View in 3D
