![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Fibronectin, different Fn3 modules [49270] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries) |
![]() | Domain d1fnfa1: 1fnf A:1142-1235 [21972] repeats 7 through 10 |
PDB Entry: 1fnf (more details), 2 Å
SCOPe Domain Sequences for d1fnfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} plspptnlhleanpdtgvltvswersttpditgyritttptngqqgnsleevvhadqssc tfdnlspgleynvsvytvkddkesvpisdtiipa
Timeline for d1fnfa1: