SCOP 1.57: Domain d1fnf_1: 1fnf 1142-1235

Lineage for d1fnf_1 (1fnf 1142-1235)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Fibronectin, different Fn3 modules [49270] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49271] (6 PDB entries)

8. Domain d1fnf_1: 1fnf 1142-1235 [21972]

Details for d1fnf_1

PDB Entry: 1fnf, 2 Å

PDB Description: fragment of human fibronectin encompassing type-iii repeats 7 through 10

SCOP Domain Sequences for d1fnf_1:

Sequence; same for both SEQRES and ATOM records:

>d1fnf_1 b.1.2.1 (1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens)}
plspptnlhleanpdtgvltvswersttpditgyritttptngqqgnsleevvhadqssc
tfdnlspgleynvsvytvkddkesvpisdtiipa

Timeline for d1fnf_1:

• d1fnf_1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnf_1 appears in SCOP 1.59
  
• d1fnf_1 appears in the current release, SCOPe 2.08, called d1fnfa1