Lineage for d4bcob1 (4bco B:175-308)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718558Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)
  8. 2718563Domain d4bcob1: 4bco B:175-308 [219433]
    Other proteins in same PDB: d4bcoa1, d4bcoa2, d4bcoc1, d4bcoc2
    automated match to d2cchb1
    complexed with sgm, so4, t6q

Details for d4bcob1

PDB Entry: 4bco (more details), 2.05 Å

PDB Description: Structure of CDK2 in complex with cyclin A and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4bcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcob1 a.74.1.1 (B:175-308) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaa

SCOPe Domain Coordinates for d4bcob1:

Click to download the PDB-style file with coordinates for d4bcob1.
(The format of our PDB-style files is described here.)

Timeline for d4bcob1: