| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries) |
| Domain d4bcod2: 4bco D:309-432 [219437] Other proteins in same PDB: d4bcoa1, d4bcoa2, d4bcoc1, d4bcoc2 automated match to d2cchb2 complexed with sgm, so4, t6q |
PDB Entry: 4bco (more details), 2.05 Å
SCOPe Domain Sequences for d4bcod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcod2 a.74.1.1 (D:309-432) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl
Timeline for d4bcod2: